ELISA Recombinant Escherichia coli Major outer membrane lipoprotein Lpp(lpp)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Signal Transduction Uniprot ID:P69776 Gene Names:lpp Organism:Escherichia coli (strain K12) AA Sequence:CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK Expression Region:21-78aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 6xHis-KSI-tagged MW:21.8 kDa Alternative Name(s):Braun lipoprotein (Murein-lipoprotein) (mLpA) (mµLI) Relevance:Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope. Reference:"Roles of the hydrophobic cavity and lid of LolA in the lipoprotein transfer reaction in Escherichia coli." Watanabe S., Matsuyama S., Tokuda H. J. Biol. Chem. 281:3335-3342(2006) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope. Involvement in disease: SubcellµLar Location:Cell outer membrane, Lipid-anchor, Cell outer membrane, Peptidoglycan-anchor Protein Families:Lpp family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ecj:JW1667 STRING Database Link:https://string-db.org/network/316385.ECDH10B_1811 OMIM Database Link: Lead Time Guidance:3-7 business days