ELISA Recombinant Tumor suppressor candidate 2(TUSC2)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Cell Biology Uniprot ID: O75896 Gene Names: TUSC2 Organism: Homo sapiens () AA Sequence: GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV Expression Region: 1-110aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 38.9 kDa Alternative Name(s): Fusion 1 protein Relevance: May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and µLtimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. Reference: "Overexpression of candidate tumor suppressor gene FUS1 isolated from the 3p21.3 homozygous deletion region leads to G1 arrest and growth inhibition of lung cancer cells." Kondo M., Ji L., Kamibayashi C., Tomizawa Y., Randle D., Sekido Y., Yokota J., Kashuba V., Zabarovsky E., Kuzmin I., Lerman M., Roth J., Minna J.D. Oncogene 20:6258-6262(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.