ELISA Recombinant TP53-regulated inhibitor of apoptosis 1(TRIAP1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Cell Biology Uniprot ID: O43715 Gene Names: TRIAP1 Organism: Homo sapiens () AA Sequence: MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS Expression Region: 1-76aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 35.8 kDa Alternative Name(s): Protein 15E1.1 WF-1 p53-inducible cell-survival factor Relevance: Involved in the modµLation of the mitochondrial apoptotic pathway by ensuring the accumµLation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis Reference: "p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway." Park W.-R., Nakamura Y. Cancer Res. 65:1197-1206(2005) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.