ELISA Recombinant Tumor protein D52(TPD52)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Cancer Uniprot ID: P55327 Gene Names: TPD52 Organism: Homo sapiens () AA Sequence: MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL Expression Region: 1-184aa Sequence Info: FµLl Length of Isoform 2 Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 35.9 kDa Alternative Name(s): Protein N8 Relevance: Reference: Transcription variants of the prostate-specific PrLZ gene and their interaction with 14-3-3 proteins.Wang R., He H., Sun X., Xu J., Marshall F.F., Zhau H., Chung L.W., Fu H., He D.Biochem. Biophys. Res. Commun. 389:455-460(2009) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.