ELISA Recombinant Transmembrane protein 132A(TMEM132A),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q24JP5 Gene Names: TMEM132A Organism: Homo sapiens () AA Sequence: QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL Expression Region: 642-742aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 17.4 kDa Alternative Name(s): HSPA5-binding protein 1 HSPA5BP1, KIAA1583 Relevance: May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cµLtured cells. RegµLates cAMP-induced GFAP gene expression via STAT3 phosphorylation Reference: "Prediction of the coding sequences of unidentified genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281(2000) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.