ELISA Recombinant TGFB1-induced anti-apoptotic factor 1(TIAF1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: O95411
Gene Names: TIAF1
Organism: Homo sapiens ()
AA Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
Expression Region: 1-115aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 39.4 kDa
Alternative Name(s): 12KDA TGF-beta-1-induced antiapoptotic factor
Relevance: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Reference: "High expression of TIAF-1 in chronic kidney and liver allograft rejection and in activated T-helper cells." van der Leij J., van den Berg A., Albrecht E.W., Blokzijl T., Roozendaal R., Gouw A.S., de Jong K.P., Stegeman C.A., van Goor H., Chang N.S., Poppema S. Transplantation 75:2076-2082(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.