Skip to Content

ELISA Recombinant Trefoil factor 1(TFF1)

https://www.scicommhub.com/web/image/product.template/140090/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: P04155 Gene Names: TFF1 Organism: Homo sapiens () AA Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF Expression Region: 25-84aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 33.7 kDa Alternative Name(s): Breast cancer estrogen-inducible protein;PNR-2;Polypeptide P1.A ;hP1.AProtein pS2 Relevance: Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine. Reference: Trefoil factor family-1 mutations enhance gastric cancer cell invasion throµgh distinct signaling pathways.Yio X., Diamond M., Zhang J.-Y., Weinstein H., Wang L.-H., Werther L., Itzkowitz S.Gastroenterology 130:1696-1706(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.