ELISA Recombinant TRAF family member-associated NF-kappa-B activator(TANK),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q92844
Gene Names: TANK
Organism: Homo sapiens ()
AA Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR
Expression Region: 1-119aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 40.8 kDa
Alternative Name(s): TRAF-interacting protein ;I-TRAF
Relevance: Adapter protein involved in I-kappa-B-kinase (IKK) regµLation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regµLator of TRAF function by maintaining th in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2.
Reference: I-TRAF is a novel TRAF-interacting protein that regµLates TRAF-mediated signal transduction.Rothe M., Xiong J., Shu H.-B., Williamson K., Goddard A., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 93:8241-8246(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.