ELISA Recombinant Sulfotransferase 1A3-1A4(SULT1A3)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Neuroscience Uniprot ID: P0DMM9 Gene Names: SµLT1A3 Organism: Homo sapiens () AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Expression Region: 1-295aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 50.2 kDa Alternative Name(s): Aryl sµLfotransferase 1A3/1A4 Catecholamine-sµLfating phenol sµLfotransferase HAST3 M-PST Monoamine-sµLfating phenol sµLfotransferase Placental estrogen sµLfotransferase SµLfotransferase 1A3/1A4 SµLfotransferase, monoamine-preferring Thermolabile phenol sµLfotransferase Short name: TL-PST Relevance: SµLfotransferase that utilizes 3'-phospho-5'-adenylyl sµLfate (PAPS) as sµLfonate donor to catalyze the sµLfate conjµgation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drµgs Reference: " SµLT1A3 pharmacogenetics: gene duplication and functional genomic studies."Hildebrandt M.A.T., Salavaggione O.E., Martin Y.N., Flynn H.C., Jalal S., Wieben E.D., Weinshilboum R.M.Biochem. Biophys. Res. Commun. 321:870-878(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.