ELISA Recombinant Small proline-rich protein 3(SPRR3)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Neuroscience Uniprot ID: Q9UBC9 Gene Names: SPRR3 Organism: Homo sapiens () AA Sequence: SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK Expression Region: 2-169aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 34 kDa Alternative Name(s): 22KDA pancornµLin Cornifin beta Esophagin Relevance: Cross-linked envelope protein of keratinocytes. Reference: "MolecµLar characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins." Gibbs S., Fijneman R., Wiegant J., Geurts van Kessel A., van de Putte P., Backendorf C.Genomics 16:630-637(1993) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.