ELISA Recombinant Small proline-rich protein 3(SPRR3)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: Q9UBC9
Gene Names: SPRR3
Organism: Homo sapiens ()
AA Sequence: SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Expression Region: 2-169aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 34 kDa
Alternative Name(s): 22KDA pancornµLin Cornifin beta Esophagin
Relevance: Cross-linked envelope protein of keratinocytes.
Reference: "MolecµLar characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins." Gibbs S., Fijneman R., Wiegant J., Geurts van Kessel A., van de Putte P., Backendorf C.Genomics 16:630-637(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.