ELISA Recombinant Striated muscle preferentially expressed protein kinase(SPEG),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Developmental Biology Uniprot ID: Q15772 Gene Names: SPEG Organism: Homo sapiens () AA Sequence: MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE Expression Region: 1-113aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal GST-tagged MW: 38.7 kDa Alternative Name(s): Aortic preferentially expressed protein 1 ;APEG-1 Relevance: Isoform 3 may have a role in regµLating the growth and differentiation of arterial smooth muscle cells. Reference: APEG-1, a novel gene preferentially expressed in aortic smooth muscle cells, is down-regµLated by vascµLar injury.Hsieh C.-M., Yoshizumi M., Endege W.O., Kho C.-J., Jain M.K., Kashiki S., de Los Santos R., Lee W.-S., Perrella M.A., Lee M.-E.J. Biol. Chem. 271:17354-17359(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.