ELISA Recombinant Sialoadhesin(SIGLEC1),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Immunology Uniprot ID:A7LCJ3 Gene Names:SIGLEC1 Organism:Sus scrofa (Pig) AA Sequence:SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG Expression Region:20-153aa Sequence Info:Partial Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:22.3 kDa Alternative Name(s):pSn;Sialic acid-binding Ig-like lectin 1;Siglec-1;p210 Relevance:Macrophage-restricted adhesion molecµLe that mediates sialic-acid dependent binding to lymphocytes, including granµLocytes, monocytes, natural killer cells, B-cells and CD8 T-cells. Preferentially binds to alpha-2,3-linked sialic acid. Binds to SPN/CD43 on T-cells. May play a role in hemopoiesis (By similarity). Acts as an endocytic receptor mediating clathrin dependent endocytosis. In case of porcine reproductive and respiratory syndrome virus (PRRSV), mediates virion attachment and internalization into alveolar macrophages throµgh a clathrin-coated dependent process. Reference:"Porcine arterivirus attachment to the macrophage-specific receptor sialoadhesin is dependent on the sialic acid-binding activity of the N-terminal immunoglobµLin domain of sialoadhesin." Delputte P.L., Van Breedam W., Delrue I., Oetke C., Crocker P.R., Nauwynck H.J. J. Virol. 81:9546-9550(2007) Purity:Greater than 90% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days