ELISA Recombinant Serpin B9(SERPINB9)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P50453
Gene Names: SERPINB9
Organism: Homo sapiens ()
AA Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
Expression Region: 1-376aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 69.4 kDa
Alternative Name(s): Cytoplasmic antiproteinase 3
Relevance: Granzyme B inhibitor.
Reference: "Serine proteinase inhibitor 9 as a tumor antigen recognized by cytotoxic T lymphocytes of epithelial cancer patients." Tanaka K., Harashima N., Shichijo S., Harada M., Itoh K. Submitted (APR-2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.