ELISA Recombinant Felis catus (Cat) (Felis silvestris catus) Amyloid protein A(SAA1),partial
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: SAA1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Felis catus (Cat) (Felis silvestris catus)
Delivery time: 3-7 business days
Uniprot ID: P19707
AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Tag info: N-terminal 6xHis-B2M-tagged
Expression Region: 1-90aa
Protein length: Partial
MW: 24.1 kDa
Alternative Name(s): Amyloid fibril protein AACurated
Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.
Reference: Initial sequence and comparative analysis of SAA cat genome.Pontius J.U., MµLlikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. , Yuhki N., Pecon-Slattery J., Johnson W.E., Bourque G., Tesler G., O'Brien S.J.Genome Res. 17:1675-1689(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.