Skip to Content

ELISA Recombinant Felis catus (Cat) (Felis silvestris catus) Amyloid protein A(SAA1),partial

https://www.scicommhub.com/web/image/product.template/127430/image_1920?unique=812c222
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: SAA1 Biologically active: Not Tested Expression system: E.coli Species of origin: Felis catus (Cat) (Felis silvestris catus) Delivery time: 3-7 business days Uniprot ID: P19707 AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG Tag info: N-terminal 6xHis-B2M-tagged Expression Region: 1-90aa Protein length: Partial MW: 24.1 kDa Alternative Name(s): Amyloid fibril protein AACurated Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex. Reference: Initial sequence and comparative analysis of SAA cat genome.Pontius J.U., MµLlikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. , Yuhki N., Pecon-Slattery J., Johnson W.E., Bourque G., Tesler G., O'Brien S.J.Genome Res. 17:1675-1689(2007) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.