Skip to Content

ELISA Recombinant Escherichia coli Peptide deformylase(def)

https://www.scicommhub.com/web/image/product.template/127214/image_1920?unique=812c222
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: Others Target / Protein: def Biologically active: Not Tested Expression system: E.coli Species of origin: Escherichia coli (strain K12) Delivery time: 3-7 business days Uniprot ID: P0A6K3 AA Sequence: SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 2-169aa Protein length: FµLl Length of Mature Protein MW: 35.2 kDa Alternative Name(s): Polypeptide deformylase Relevance: Roves the formyl group from the N-terminal Met of newly synthe>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantityd proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions. Reference: Structural basis for the design of antibiotics targeting peptide deformylase.Hao B., Gong W., Rajagopalan P.T.R., Zhou Y., Pei D., Chan M.K.Biochemistry 38:4712-4719(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.