Skip to Content

ELISA Recombinant Transcription initiation factor IIA subunit 2(GTF2A2)

https://www.scicommhub.com/web/image/product.template/139809/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Epigenetics and Nuclear Signaling Uniprot ID: P52657 Gene Names: GTF2A2 Organism: Homo sapiens () AA Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Expression Region: 1-109aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 39.5 kDa Alternative Name(s): General transcription factor IIA subunit 2 TFIIA p12 subunit Relevance: TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. Reference: "Reconstitution of TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription." Sun X., Ma D., Sheldon M., Yeung K., Reinberg D. Genes Dev. 8:2336-2348(1994) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.