ELISA Recombinant Sodium-potassium-transporting ATPase subunit gamma(FXYD2)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Neuroscience Uniprot ID: P54710 Gene Names: FXYD2 Organism: Homo sapiens () AA Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP Expression Region: 1-64aa Sequence Info: FµLl Length of Isoform 2 Source: E.coli Tag Info: N-terminal GST-tagged MW: 34.4 kDa Alternative Name(s): FXYD domain-containing ion transport regµLator 2 Sodium pump gamma chain Relevance: May be involved in forming the receptor site for cardiac glycoside binding or may modµLate the transport function of the sodium ATPase. Reference: "Dominant isolated renal magnesium loss is caused by misrouting of the Na+,K+-ATPase gamma-subunit." Meij I.C., Koenderink J.B., van Bokhoven H., Assink K.F.H., Groenestege W.T., de Pont J.J.H.H.M., Bindels R.J.M., Monnens L.A.H., van den Heuvel L.P.W.J., Knoers N.V.A.M. Nat. Genet. 26:265-266(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.