ELISA Recombinant IgG receptor FcRn large subunit p51(FCGRT),partial
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: FCGRT
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens ()
Delivery time: 3-7 business days
Uniprot ID: P55899
AA Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Tag info: N-terminal GST-tagged
Expression Region: 24-297aa
Protein length: ExtracellµLar Domain
MW: 57.4 kDa
Alternative Name(s): IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Relevance: Binds to the Fc region of monomeric immunoglobµLins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobµLin G from mother to fetus.
Reference: The fµLl-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.