ELISA Recombinant Faba bean necrotic yellows virus Putative movement protein(DNA-M)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Faba bean necrotic yellows virus (isolate Egyptian EV1-93) (FBNYV) Uniprot NO.:Q9WIJ7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MADTGYYAGYQDDVDVDEQKRHQALYLIGIILLVTVCLTVLWVCImLACYVPGFLKKTLE AWLNSSSLMKRRVASTLTRTPFEATGPERERNWEARRQSTTVNPASQPNTGSVF Protein Names:Recommended name: Putative movement protein Short name= MP Gene Names:Name:DNA-M Synonyms:C4 Expression Region:1-114 Sequence Info:fµLl length protein