ELISA Recombinant Transmembrane and coiled-coil domain-containing protein 1(TMCO1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9UM00 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS Protein Names:Recommended name: Transmembrane and coiled-coil domain-containing protein 1 Alternative name(s): Transmembrane and coiled-coil domains protein 4 Xenogeneic cross-immune protein PCIA3 Gene Names:Name:TMCO1 Synonyms:TMCC4 ORF Names:PNAS-10, PNAS-136, UNQ151/PRO177 Expression Region:1-188 Sequence Info:fµLl length protein