ELISA Recombinant Transmembrane and coiled-coil domain-containing protein 1(TMCO1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q9UM00
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS
Protein Names:Recommended name: Transmembrane and coiled-coil domain-containing protein 1 Alternative name(s): Transmembrane and coiled-coil domains protein 4 Xenogeneic cross-immune protein PCIA3
Gene Names:Name:TMCO1 Synonyms:TMCC4 ORF Names:PNAS-10, PNAS-136, UNQ151/PRO177
Expression Region:1-188
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.