ELISA Recombinant Escherichia coli Uncharacterized membrane protein YuaD(yuaD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:Q9JMT6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRAYCPHYQFmLFWIASLCWFSLIVLWGTGFYSLLFYIISVLLIIILYTLYFIGENMFSK GKIKESDSTTTIISKNTSFVGDISSGEKIIIHGKINGNINTNNGVVFIDKGGVVNGRVLC EKMILNGELYGECCCSTLDVYENGFLQGEVSYRFLEIRNGGCITGIVNKVTDEVQNNVSE LVKARES Protein Names:Recommended name: Uncharacterized membrane protein YuaD Gene Names:Name:yuaD Synonyms:ybcA Ordered Locus Names:ECOK12F013 Expression Region:1-187 Sequence Info:fµLl length protein