ELISA Recombinant Translocase of inner mitochondrial membrane domain-containing protein 1(TIMMDC1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9NPL8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRE LFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFR INVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRL QVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD Protein Names:Recommended name: Translocase of inner mitochondrial membrane domain-containing protein 1 Alternative name(s): Protein M5-14 Gene Names:Name:TIMMDC1 Synonyms:C3orf1 ORF Names:UNQ247/PRO284 Expression Region:1-285 Sequence Info:fµLl length protein