Skip to Content

ELISA Recombinant Fowlpox virus G-protein coupled receptor homolog FPV021(FPV021)

https://www.scicommhub.com/web/image/product.template/127455/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Fowlpox virus (strain NVSL) (FPV) Uniprot NO.:Q9J5I0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDTDYGTVHTQQSVKGNTLILLIYFISFIVGFPGNCTVIWFTGYRWKKSVTTIWFLNLAI ADTLFVIFIPFEITYILMGHYWPFGLFVCRIGSLMFNTGMYASIFFLTFISIDRYCLAFR RDICNKYRYRINIMVMIIISWIISILLSTPYMYFKNTNEKYRNNRDCLEDYHSDNNTYLL RRVVFCISLVMRYLVPSVVmLFCYCLLLFKHSLFLSKGQTYTIVIMITSFMVLWTPYNIL YFIDVIGSHYYNADTIIDAAPISISLIFLSSSINPMIYmLVGRYVSFENYSMRESLKLIL SEERDNQTNHENEIKMENIN Protein Names:Recommended name: G-protein coupled receptor homolog FPV021 Gene Names:Ordered Locus Names:FPV021 Expression Region:1-320 Sequence Info:fµLl length protein

1,673.00 € 1673.0 EUR 1,673.00 €

1,673.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days