ELISA Recombinant Fowlpox virus Immunodominant envelope protein p35(FPV140)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Fowlpox virus (strain NVSL) (FPV) Uniprot NO.:Q9J590 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPGDKKQIIFVITTIGRPSSTVVPFKNLEVSEWSYKKGIKNGYDDYRDPPSPKPLPKSK QEPNADDKVGDIEYDEMVSVRDGYYSDVCRLTCTEDTKIFIADHISLWRYIMDNAEKLPN YVVIMEDDNTITGEGFITNLDNITKVLNDNNVDILQLVTHTKLLKDRNSQHLmLLPDLEA FKGSFDVSLSAYIIRQEAVRKLYSYFTNNKPSFDISLEILRIENTLGITRYVVDNDRYVY HDYKLANEFMKNKKNRLSIKSRIDGWIMDNWPSFYHRMYYPLFSVFGKYDITMMFLIAIV IIIGLAIFDINNKLLWLLSGVFLAYSM Protein Names:Recommended name: Immunodominant envelope protein p35 Alternative name(s): Ag35 Virion envelope protein p35 Gene Names:Ordered Locus Names:FPV140 Expression Region:1-327 Sequence Info:fµLl length protein