Skip to Content

ELISA Recombinant UDP-glucuronosyltransferase 1-7(UGT1A7)

https://www.scicommhub.com/web/image/product.template/140433/image_1920?unique=bf930ac
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9HAW7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLED QDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSNCRSLFNDRKLVEYLKESCFDAV FLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEGAQCPAPLSYVPRLLLGFSDAMTFKE RVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVTAYDLYSHTSIWLLRTDFVLEYPKPV MPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGK IPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPM VMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHK DRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFK CCAYGYRKCLGKKGRVKKAHKSKTH Protein Names:Recommended name: UDP-glucuronosyltransferase 1-7 Short name= UDPGT 1-7 Short name= µgT1*7 Short name= µgT1-07 Short name= µgT1.7 EC= 2.4.1.17 Alternative name(s): UDP-glucuronosyltransferase 1-G Short name= Gene Names:Name:µgT1A7 Synonyms:GNT1, µgT1 Expression Region:26-530 Sequence Info:fµLl length protein

1,868.00 € 1868.0 EUR 1,868.00 €

1,868.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.