ELISA Recombinant Transmembrane protein 9B(TMEM9B)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9NQ34 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKY EERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFA NAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS Protein Names:Recommended name: Transmembrane protein 9B Gene Names:Name:TMEM9B Synonyms:C11orf15 ORF Names:UNQ712/PRO1375 Expression Region:34-198 Sequence Info:fµLl length protein