Skip to Content

ELISA Recombinant Fowlpox virus G-protein coupled receptor homolog FPV027(FPV027)

https://www.scicommhub.com/web/image/product.template/127456/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Fowlpox virus (strain NVSL) (FPV) Uniprot NO.:Q9J5H4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSMNNITSKMNQDSYGYFQLHMSDFTRVSLSIVFTLVFLVGIIGNAVIIWFIGFKWTKTI STLLFINLALADSLFLIFIPVYTVYVLSNFHWYLGEFLCRVSSFFFTTNMYASMFLLTFI SIDKYLTLTSHRLVYKYRKYRNYYVCIGAIWCISIALGVPTLYYKRVILSSSRNETRCIS YYGDDKHTAITIYRIIVCIRFIIGYVFPMTVILLSYALIVYKVKFINKPPNRSFMITTAS IFVFLACWTPHHVLNIISLYGLKSTSMYNYIKESIPFVNAIAFVYSAINPIIYIFVIRLT STYDSDTMDELRSALLDEETTSTEDCSDIEISDISR Protein Names:Recommended name: G-protein coupled receptor homolog FPV027 Gene Names:Ordered Locus Names:FPV027 Expression Region:1-336 Sequence Info:fµLl length protein

1,690.00 € 1690.0 EUR 1,690.00 €

1,690.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days