ELISA Recombinant Trimeric intracellular cation channel type A(TMEM38A)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q9H6F2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPGAVELSRRHPIASWLCAmL HCFGSYILADLLLGEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVA MKEVVRVRKIAVGIHHAHHHYHHGWFVMIATGWVKGSGVALMSNFEQLLRGVWKPETNEI LHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFIFTLFMVSCKVFLTATHSHSSPFDAL EGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKKKAKKAD
Protein Names:Recommended name: Trimeric intracellµLar cation channel type A Short name= TRIC-A Short name= TRICA Alternative name(s): Transmembrane protein 38A
Gene Names:Name:TMEM38A
Expression Region:1-299
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.