Skip to Content

ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 5(PCR5)

https://www.scicommhub.com/web/image/product.template/117045/image_1920?unique=a9584cd
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9LS45 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRPVGQTNQAQPSVQHTASPSNKVSHNGGIGKPANIPTGIPVNYQQTQNQWSSQLFDCM NDSENAVITLIAPCVTFGQIAEIVDEGATPCATAGLLYGALFFTGASFVYSYMFRARIRK KFGLPDAPAPDWITHLVCMPFALCQEYRELKHHGFDPILGWAGNVQQAQQQEMMTPPTGQ RMMG Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 5 Short name= AtPCR5 Gene Names:Name:PCR5 Ordered Locus Names:At3g18450 ORF Names:MYF24.17 Expression Region:1-184 Sequence Info:fµLl length protein

1,529.00 € 1529.0 EUR 1,529.00 €

1,529.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days