ELISA Recombinant Uncharacterized protein C1orf43(C1orf43)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q9BWL3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSE GRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQ EALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELK SFKDNYNTLESTL
Protein Names:Recommended name: Uncharacterized protein C1orf43 Alternative name(s): Hepatitis C virus NS5A-transactivated protein 4 Short name= HCV NS5A-transactivated protein 4 Protein NICE-3 S863-3
Gene Names:Name:C1orf43 Synonyms:NICE3, NS5ATP4 ORF Names:HSPC012
Expression Region:1-253
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.