ELISA Recombinant Uncharacterized protein C1orf43(C1orf43)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BWL3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSE GRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQ EALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELK SFKDNYNTLESTL Protein Names:Recommended name: Uncharacterized protein C1orf43 Alternative name(s): Hepatitis C virus NS5A-transactivated protein 4 Short name= HCV NS5A-transactivated protein 4 Protein NICE-3 S863-3 Gene Names:Name:C1orf43 Synonyms:NICE3, NS5ATP4 ORF Names:HSPC012 Expression Region:1-253 Sequence Info:fµLl length protein