ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 8(PCR8)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9M815
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGRVTTPSEEDSNNGLPVQQPGTPNQRTRVPVSQFAPPNYQQANVNLSVGRPWSTGLFDC QADQANAVLTTIVPCVTFGQIAEVMDEGEMTCPLGTFMYLLMMPALCSHWVMGSKYREKM RRKFNLVEAPYSDCASHVLCPCCSLCQEYRELKIRNLDPSLGWNGILAQGQGQYEREAPS FAPTNQYMSK
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 8 Short name= AtPCR8
Gene Names:Name:PCR8 Ordered Locus Names:At1g52200 ORF Names:F9I5.19
Expression Region:1-190
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.