ELISA Recombinant Fowlpox virus Late protein H7 homolog(FPV144)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Fowlpox virus (strain NVSL) (FPV)
Uniprot NO.:Q9J586
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDHKSRmLLDTIFKDmLNTKDVYALIKYIFKKDPVETIFSKKDDDIFIDFVYNDNVLASD YLGMKTTKVEDCCSCRKVVAVEYMNTSIIDNDLEGYIKQSDKLKRFIKLYNKNNAIKKAR NIKSRQKmLKDAGIDDIGYEFIKDAIGLISRK
Protein Names:Recommended name: Late protein H7 homolog
Gene Names:Ordered Locus Names:FPV144
Expression Region:1-152
Sequence Info:fµLl length protein