Skip to Content

ELISA Recombinant Fowlpox virus G-protein coupled receptor homolog FPV206(FPV206)

https://www.scicommhub.com/web/image/product.template/127457/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Fowlpox virus (strain NVSL) (FPV) Uniprot NO.:Q9J529 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFTGDCLLYAGYEKLSLSLAVVTILIFSSSLILNISALVIGFYTTAPGPMKMYLINLIV SDILFTVTLPLKIDYYYYFFNWRWGEMACRIMSFLSYINTYVSINFMTWISVNRYYAVTR PHKYNSRDNIMRTKIACACTWVIILVPMSSILFVSTTSSDHETKIRCMEYNKVGDSMYLP PWVTIVMCFIGFVIPFAMMAISYSAVCYTVLSGISKSTRSYRTCKLVACILTEFVICFLP YHASVISYMIHIITSKTVLCENVSYYQmLLHATQCLMKLNCCMDPIIYLFVSSYKSKAKS NSIKLMFK Protein Names:Recommended name: G-protein coupled receptor homolog FPV206 Gene Names:Ordered Locus Names:FPV206 Expression Region:1-308 Sequence Info:fµLl length protein

1,660.00 € 1660.0 EUR 1,660.00 €

1,660.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.