ELISA Recombinant Sugar transporter SWEET1(SLC50A1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BRV3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY GALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGF RLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT Protein Names:Recommended name: Sµgar transporter SWEET1 Short name= HsSWEET1 Alternative name(s): RAG1-activating protein 1 Solute carrier family 50 member 1 Stromal cell protein Gene Names:Name:SLC50A1 Synonyms:RAG1AP1, SCP Expression Region:1-221 Sequence Info:fµLl length protein