Skip to Content

ELISA Recombinant TM2 domain-containing protein 3(TM2D3)

https://www.scicommhub.com/web/image/product.template/139684/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BRN9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GEQSQALAQSIKDPGPTRTFTVVPRAAESTEIPPYVMKCPSNGLCSRLPADCIDCTTNFS CTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC PRQRYPANCTVRDHVHCLGNRTFPKmLYCNWTGGYKWSTALALSITLGGFGADRFYLGQW REGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI Protein Names:Recommended name: TM2 domain-containing protein 3 Alternative name(s): Beta-amyloid-binding protein-like protein 2 Short name= BBP-like protein 2 Gene Names:Name:TM2D3 Synonyms:BLP2 Expression Region:30-247 Sequence Info:fµLl length protein

1,565.00 € 1565.0 EUR 1,565.00 €

1,565.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.