ELISA Recombinant Transmembrane protein 229B(TMEM229B)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NBD8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNLNWKFPGVTSVWALFIYGTSILIV ERMYLRLRGRCPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY AVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPSGALALANGHVKTD Protein Names:Recommended name: Transmembrane protein 229B Gene Names:Name:TMEM229B Synonyms:C14orf83 Expression Region:1-167 Sequence Info:fµLl length protein