ELISA Recombinant Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 3(NKAIN3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8N8D7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGCCTGRCSLICLCALQLVSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPR YIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLP PSAHGMMDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTYSC DLQVCKHLFIQmLQIIE Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 3 Alternative name(s): Protein FAM77D Gene Names:Name:NKAIN3 Synonyms:FAM77D Expression Region:1-197 Sequence Info:fµLl length protein