ELISA Recombinant UPF0414 transmembrane protein C20orf30(C20orf30)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96A57 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLI IIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD Protein Names:Recommended name: UPF0414 transmembrane protein C20orf30 Gene Names:Name:C20orf30 ORF Names:HSPC274, UNQ2432/PRO4992 Expression Region:1-120 Sequence Info:fµLl length protein