ELISA Recombinant Trace amine-associated receptor 8(TAAR8)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q969N4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFK QLHSPTNFLIASLACADFLVGVTVmLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVL HLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELV SALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESS SESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAY YNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE
Protein Names:Recommended name: Trace amine-associated receptor 8 Short name= TaR-8 Short name= Trace amine receptor 8 Alternative name(s): G-protein coupled receptor 102 Trace amine receptor 5 Short name= TaR-5
Gene Names:Name:TAAR8 Synonyms:GPR102, TA5, TAR5, TRAR5
Expression Region:1-342
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.