ELISA Recombinant Transmembrane protein 234(TMEM234)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8WY98 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMP FLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVI GISLCITSSVPWTAELQLHGKGQLQTLSQKCKREASGTQSERFG Protein Names:Recommended name: Transmembrane protein 234 Gene Names:Name:TMEM234 Synonyms:C1orf91 ORF Names:PP1065, UNQ548/PRO1105 Expression Region:1-164 Sequence Info:fµLl length protein