ELISA Recombinant Transmembrane protein C9orf71(C9orf71)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8N6L7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQNRTGLILCALALLMGFLMVCLGAFFISWGSIFDCQGSLIAAYLLLPLGFVILLSGIFW SNYRQVTESKGVLRHmLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAEREASG IPPPLYTETGLEFQDGNDSHPEAPPSYRESIAGLVVTAISEDAQRRGQEC Protein Names:Recommended name: Transmembrane protein C9orf71 Gene Names:Name:C9orf71 Expression Region:1-170 Sequence Info:fµLl length protein