ELISA Recombinant Transmembrane 4 L6 family member 19(TM4SF19)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96DZ7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSSPCTQASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAmLGTG LWGGGLMVLTAAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALK DGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSAL LCISLLQLLLVVVHVINSLLGLFCSLCEK Protein Names:Recommended name: Transmembrane 4 L6 family member 19 Alternative name(s): Osteoclast maturation-associated gene 4 protein Tetraspan membrane protein OCTM4 Gene Names:Name:TM4SF19 ORF Names:OCTM4 Expression Region:1-209 Sequence Info:fµLl length protein