ELISA Recombinant Ferrous iron permease EfeU(efeU)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O6 Uniprot NO.:Q8FJ36 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFVPFLIILREGLEAALIVSLIASYLTRTQRGRWIGVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAmLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFVLPPRAGATASRSM Protein Names:Recommended name: Ferrous iron permease EfeU Alternative name(s): Fe(2+) ion permease EfeU Ferrous iron uptake protein Gene Names:Name:efeU Ordered Locus Names:c1155 Expression Region:1-276 Sequence Info:fµLl length protein