ELISA Recombinant Folate transporter FolT(folT)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus mutans Uniprot NO.:Q8DV98 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNTMFKSPKLSPQRLVTLAmLIALAFAIGKLSIPIIPQQLIISPTFIVNVMIGMIGGPIW AFISLAILDIVDNLSSGAGNFIIWWTLLEAVQGLFYGLFFYQKSLSWTNKKDWLHVTIAT AIImLIGSFIFTPLLVQIYYGVPFWAQFAAGRWLKIFEIPIRILVTMAIMPQLQRIPELR KLANFK Protein Names:Recommended name: Folate transporter FolT Alternative name(s): Folate ECF transporter S component FolT Gene Names:Name:folT Ordered Locus Names:SMU_600c Expression Region:1-186 Sequence Info:fµLl length protein