ELISA Recombinant Flavobacterium johnsoniae Aquaporin Z(aqpZ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Flavobacterium johnsoniae (Cytophaga johnsonae) Uniprot NO.:Q7WVD3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKLFAEFFGTYWLVFGGCGSAVFAAGYPTLGIGFAGVALAFGLTVLTMAYAVGHISGGH FNPAVSFGLWAGGRFSAKD Protein Names:Recommended name: Aquaporin Z Gene Names:Name:aqpZ Synonyms:fjo22 Expression Region:1-79 Sequence Info:fµLl length protein