Skip to Content

ELISA Recombinant Ferrous iron permease EfeU(efeU)

https://www.scicommhub.com/web/image/product.template/112945/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shigella flexneri Uniprot NO.:Q83LK5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSRSRQAAYSGIFINETTGEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQL EQAVDSALQRGNHHGWALVMMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAmLGLATA VVLGFLLYWGGIRLNLGAFFKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSA VLSTHSLFGTLMEGIFGYQEAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA Protein Names:Recommended name: Ferrous iron permease EfeU Alternative name(s): Fe(2+) ion permease EfeU Ferrous iron uptake protein Gene Names:Name:efeU Ordered Locus Names:SF1019, S1089 Expression Region:1-235 Sequence Info:fµLl length protein

1,583.00 € 1583.0 EUR 1,583.00 €

1,583.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.