ELISA Recombinant Fowlpox virus Protein J5 homolog(FPV136)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Fowlpox virus (strain NVSL) (FPV)
Uniprot NO.:Q85281
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDNVINDEAIFKYCESNPKDRDCLCIHPEPTIEKIGEDLLLPYYCWYEPCKRKTAKIPTA LRDNMKRCNLIDCSVSLGEINLLDGILKVNNDCLSSHAIYAGYSVKPLEQEIHLPIIDPK YLILGLAILALIVLINW
Protein Names:Recommended name: Protein J5 homolog Alternative name(s): FPV136
Gene Names:Ordered Locus Names:FPV136 ORF Names:F11
Expression Region:1-137
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF768038FEY
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.