ELISA Recombinant Eschrichtius gibbosus NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Eschrichtius gibbosus (California gray whale) (Eschrichtius robustus)
Uniprot NO.:Q70S06
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTLIHMNILMAFSMSLVGLLMYRSHLMSALLCLEGMmLSLFVLAALTILNSHFTLANMMP IILLVFAACEAAIGLALLVMVSNTYGTDYVQNLNLLQC
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L
Gene Names:Name:MT-ND4L Synonyms:MTND4L, NADH4L, ND4L
Expression Region:1-98
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF758233EHC-GB
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.