ELISA Recombinant Uncharacterized protein ATPAF1-AS1(ATPAF1-AS1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q6PEX7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDSQQEDLRFPGMWVSLYFGILGLCSVITGGCIIFLHWRKNLRREEHAQQWVEVMRAATF TYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLDIPEGRSHADQDSNP KAEAPAPLQPALQLAPQQPQARSPFPLPIFQEVPFAPPLCNLPPLLNHSVSYPLATCPER NVLFHSLLNLAQEDHSFNAKPFPSEL Protein Names:Recommended name: Uncharacterized protein ATPAF1-AS1 Alternative name(s): ATPAF1 antisense RNA 1 ATPAF1 antisense gene protein 1 Gene Names:Name:ATPAF1-AS1 Synonyms:C1orf223 Expression Region:1-206 Sequence Info:fµLl length protein