Skip to Content

ELISA Recombinant European mountain ash ringspot-associated virus Envelope glycoprotein

https://www.scicommhub.com/web/image/product.template/127391/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:European mountain ash ringspot-associated virus (isolate Sorbus aucuparia) (EMARAV) Uniprot NO.:Q6Q304 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DDNVYNYYEHGDLTEIQLLDKEHYSQDFVSDGFLYNFYVENSHLIYDISNISTITRPVKH NEVTSTWSCDGSSGCYKDHVGKYNKKPDYVLKKVHDGFSCFFTTATICGTCKSEHIAIGD HVRVINVKPYIHIVVKTANKTDKIVIDEFNKFIHEPYYIKPITQIHIDQHDFLVTGSKVY QGTFCERPSKSCFGPNYITSDKTVTLHEPKIRDTFTHDREYIIDYCDYPSNSDLESLELT DMVHHSDKIYSPYDFGLISIGIPKLGYLAGGFCESLVSVKKIEVYGCYDCQNGVKISVTY ESSDSCHTLICKHDSTTHRYFVQQHTTTLNFHSFMSKKDTIIECNQMRKALNLDESSETS VYFESNGVKGSAKEPVNFDFIKNLLYIDYKKIIFVFLVAIISIGIFLRSPYmLLSSILKF RKRRKVVATNRSEQLVMDDDVDVFIGPPS Protein Names:Recommended name: Envelope glycoprotein Short name= GP Cleaved into the following 2 chains: 1. Glycoprotein G2 2. Glycoprotein G1 Gene Names: Expression Region:198-646 Sequence Info:fµLl length protein

1,809.00 € 1809.0 EUR 1,809.00 €

1,809.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days